PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G14780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BES1
Protein Properties Length: 134aa    MW: 14445.4 Da    PI: 11.1544
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G14780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82291.81.6e-2853125276
        DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                   +s r+pt +ErEnn++R R         yaGLRa ++y+lpk+aD+n+Vl+ALc+eAG++v+dDG++ r++   +
  OB01G14780.1  53 TSLRHPTPRERENNRQRGRX--XXXXXXYAGLRASAGYALPKHADQNDVLRALCAEAGYLVDDDGNVSRRHEVVT 125
                   789***********998776..567889*****************************************987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-2055120IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MEVAAAGREE GGGEVAMAMA PEKAAAGRRR GCIRSTRGPW TVRRRGRGGS VTTSLRHPTP  60
RERENNRQRG RXXXXXXXYA GLRASAGYAL PKHADQNDVL RALCAEAGYL VDDDGNVSRR  120
HEVVTSTPLA SASS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0025239e-57AP002523.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0013F10.
GenBankAP0149579e-57AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126099e-57CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232995.11e-39PREDICTED: BES1/BZR1 homolog protein 2-like
TrEMBLJ3KWX22e-85J3KWX2_ORYBR; Uncharacterized protein
STRINGOB01G14780.16e-85(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132013032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.11e-13BES1/BZR1 homolog 2